PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aqcoe3G402700.3.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; stem eudicotyledons; Ranunculales; Ranunculaceae; Thalictroideae; Aquilegia
Family MYB
Protein Properties Length: 663aa    MW: 74929.1 Da    PI: 6.5188
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Aqcoe3G402700.3.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding24.94.6e-08217261246
                        SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
    Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                        ++W+  Ed+ l+  v+  G  +W  Ia t+g++Rt+ qc  r+q 
  Aqcoe3G402700.3.p 217 NSWSNTEDKELISIVQNSGIYNWIEIATTLGTNRTPFQCLARYQR 261
                        58*****************************************96 PP

2Myb_DNA-binding42.12e-13269315148
                        TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
    Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                        ++ WT+e+d +l +av+  G ++W  +a+++  +Rt+ qc +rw k l
  Aqcoe3G402700.3.p 269 KQEWTAEDDAQLCEAVEACGENDWQQVASKLE-RRTGVQCSNRWMKTL 315
                        789*****************************.***********9975 PP

3Myb_DNA-binding41.14.2e-13323368248
                        SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
    Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                        grWT eEd  l+ av ++ ++ W++Ia+ +  gRt  qc++rw ++l
  Aqcoe3G402700.3.p 323 GRWTVEEDRHLKVAVMLFKPKMWHKIAQFVS-GRTQVQCRERWVNVL 368
                        8******************************.***********9975 PP

4Myb_DNA-binding43.95.6e-14375416245
                        SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
    Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 
                        + WT+eEd +l+ a+ ++G   W+++a+ +   Rt++qc+ rw 
  Aqcoe3G402700.3.p 375 QEWTEEEDTKLKAAIVEHGHC-WSKVAASVA-PRTDNQCRRRWK 416
                        57*****************99.*********.9**********6 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS500905.552111210IPR017877Myb-like domain
SMARTSM007170.0066115212IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.6E-6118134IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.6E-6183219IPR009057Homeodomain-like
SuperFamilySSF466892.11E-14193260IPR009057Homeodomain-like
PROSITE profilePS500909.036211263IPR017877Myb-like domain
SMARTSM007173.8E-4215265IPR001005SANT/Myb domain
PfamPF002495.5E-6217261IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.607.0E-14220272IPR009057Homeodomain-like
SuperFamilySSF466894.16E-19249318IPR009057Homeodomain-like
PROSITE profilePS5129419.607264319IPR017930Myb domain
SMARTSM007176.3E-14268317IPR001005SANT/Myb domain
PfamPF002491.8E-11269314IPR001005SANT/Myb domain
CDDcd001675.40E-11271315No hitNo description
Gene3DG3DSA:1.10.10.604.7E-16273318IPR009057Homeodomain-like
SuperFamilySSF466891.73E-24321415IPR009057Homeodomain-like
SMARTSM007176.3E-11321370IPR001005SANT/Myb domain
PROSITE profilePS5129410.134321368IPR017930Myb domain
PfamPF002498.1E-12323368IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.3E-16323371IPR009057Homeodomain-like
CDDcd001672.25E-9324368No hitNo description
PROSITE profilePS5129422.3369423IPR017930Myb domain
Gene3DG3DSA:1.10.10.607.1E-18372419IPR009057Homeodomain-like
SMARTSM007176.1E-13373421IPR001005SANT/Myb domain
PfamPF002491.5E-12375416IPR001005SANT/Myb domain
CDDcd001676.41E-12376419No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 663 aa     Download sequence    Send to blast
MSSRGSDVDE EDDDSETLGA IEKRFSIYGS DCPIENLESL LSKPELVHTT STDLESEATN  60
ILSITKPSPQ ALDKALTDPQ QVNDKKLPAL FNGPVENPHV ANYRMVLMKF PVSLHRNKWS  120
EKDKENLRRG IEQQFQEMLF QKSVEVYSGA DECSGDSNTF DNVVTSISDI EITPEKIRSF  180
LPKVDWQRLA SMYASGRSGA ECETRWVNNE DPLINHNSWS NTEDKELISI VQNSGIYNWI  240
EIATTLGTNR TPFQCLARYQ RSLNCHIMKQ EWTAEDDAQL CEAVEACGEN DWQQVASKLE  300
RRTGVQCSNR WMKTLNPARE RVGRWTVEED RHLKVAVMLF KPKMWHKIAQ FVSGRTQVQC  360
RERWVNVLDP SLNLQEWTEE EDTKLKAAIV EHGHCWSKVA ASVAPRTDNQ CRRRWKILLP  420
HEVPLLQAAR RIEKSSLISN FVDREEERPG LSSSDFLPLP GIDAPEAENG TSSKEKNTKS  480
STTTYKAICE KSPTEAPLSK EASMMIHDDI VEPFGGDDSV SKNKKTHKLQ LKRKRCSEPA  540
HVLNQELPRS LQPSSDGTSS KKKTQPRTPG DGTKGLQDDS VLADSSRTDV LLTKRRKVPK  600
PPSKRNKSTA SAKHQEPLSP ELPTISRMTA LEPTINNSDR SYFTQKEEAC SPRQLDDCFK  660
FS*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h88_C1e-291854153155MYB PROTO-ONCOGENE PROTEIN
1h89_C1e-291854153155MYB PROTO-ONCOGENE PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010243797.10.0PREDICTED: uncharacterized protein LOC104587774 isoform X1
RefseqXP_010243798.10.0PREDICTED: uncharacterized protein LOC104587774 isoform X2
TrEMBLA0A068TQ561e-176A0A068TQ56_COFCA; Uncharacterized protein
STRINGPOPTR_0015s04260.11e-169(Populus trichocarpa)
STRINGGSMUA_Achr9P10150_0011e-170(Musa acuminata)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G18100.21e-149myb domain protein 4r1